Reliable Supplier Tgl Gf Couplings - Tyre Couplings Complete Set Type F/H/B with Rubber Tire – GOODLUCK

Product Detail

Product Tags

Feedback (2)

We insist on offering premium quality manufacturing with superior business concept, honest product sales as well as finest and fast assistance. it will bring you not only the good quality product or service and huge profit, but the most significant is to occupy the endless market for Mct Couplings, Vertical Chain Conveyor, Motorcycle Chain Tool, Should further information be required, please contact us at any time!

Reliable Supplier Tgl Gf Couplings - Tyre Couplings Complete Set Type F/H/B with Rubber Tire – GOODLUCK Detail:

FFX Tyre Couplings
Tyre Couplings1

Size	Bush Size	Max Bore		A	B	C	E	F&H		TypeB BSL		Clamping Screw	Weight	Inertia
Size	Bush Size	Metric	Inch	A	B	C	E	F&H		TypeB BSL		Clamping Screw	Weight	Inertia
								F	D	F	D		(kg)	(kg²)
				mm	mm	mm	mm	mm	mm	mm	mm
FFX040B	12	32	-	104	-	82	11.0	-	-	33.0	22	M5	0.8	0.00074
FFX040F	1008	25	1	104	-	82	11.0	33.0	22	-	-	-	0.8	0.00074
FFX040H	1008	25	1	104	-	82	11.0	33.0	22	-	-	-	0.8	0.00074
FFX050B	15	38	-	133	79	100	12.5	-	-	45.0	32	M5	1.2	0.00115
FFX050F	1210	32	1.1/4″	133	79	100	12.5	38.0	25	-	-	-	1.2	0.00115
FFX050H	1210	32	1.1/4″	133	79	100	12.5	38.0	25	-	-	-	1.2	0.00115
FFX060B	18	45	-	165	70	125	16.5	-	-	55.0	38	M6	2.0	0.0052
FFX060F	1610	42	1.5/8″	165	103	125	16.5	42.0	25	-	-	-	2.0	0.0052
FFX060H	1610	42	1.5/8″	165	103	125	16.5	42.0	25	-	-	-	2.0	0.0052
FFX070B	22	50	-	187	80	144	11.5	-	-	47.0	35	M10	3.1	0.009
FFX070F	2012	50	2″	187	80	144	11.5	44.0	32	-	-	-	3.1	0.009
FFX070H	1610	42	1.5/8″	187	80	144	11.5	42.0	25	-	-	-	3.0	0.009
FFX080B	25	60	-	211	98	167	12.5	-	-	55.0	42	M10	4.9	0.018
FFX080F	2517	60	2.1/2″	211	97	167	12.5	58.0	45	-	-	-	4.9	0.018
FFX080H	2012	50	2″	211	98	167	12.5	45.0	32	-	-	-	4.6	0.017
FFX090B	28	70	-	235	112	188	13.5	-	-	63.5	49	M12	7,1	0.032
FFX090F	2517	60	2.1/2″	235	108	188	13.5	59.5	45	-	-	-	7.0	0.031
FFX090H	2517	60	2.1/2″	235	108	188	13.5	59.5	45	-	-	-	7,1	0.031
FFX1OOB	32	80	-	254	125	216	13.5	-	-	70.5	56	M12	9.9	0.055
FFX100F	3020	75	3″	254	120	216	13.5	65.5	51	-	-	-	9.9	0.055
FFX100H	2517	60	2.1/2″	254	113	216	13.5	59.5	45	-	-	-	9.4	0.054
FFX110B	30	90	-	279	128	233	12.5	-	-	75.5	63	M12	12.5	0.081
FFX110F	3020	75	3″	279	134	233	12.5	63.5	51	-	-	-	11.7	0.078
FFX110H	3020	75	3″	279	134	233	12.5	63.5	51	-	-	-	11.7	0.078
FFX120B	38	100	-	314	143	264	14.5	-	-	84.5	70	M16	16.9	0.137
FFX120F	3525	100	4″	314	140	264	14.5	79.5	65	-	-	-	16.5	0.137
FFX120H	3020	75	3″	314	140	264	14.5	65.5	51	-	-	-	15.9	0.13
FFX140B	75	130	-	359	178	311	16.0	-	-	110.5	94	M20	22.2	0.254
FFX140F	3525	100	4″	359	178	311	16.0	81.5	65	-	-	-	22.3	0.255
FFX140H	3525	100	4″	359	178	311	16.0	81.5	65	-	-	-	22.3	0.255
FFX160B	75	140	-	402	187	345	15.0	-	-	117.0	102	M20	35.8	0.469
FFX160F	4030	115	4.1/2″	402	197	345	15.0	92.0	77	-	-	-	32.5	0.38
FFX160H	4030	115	4.1/2″	402	197	345	15.0	92.0	77	-	-	-	32.5	0.38
FFX180B	75	150	-	470	200	398	23.0	-	-	137.0	114	M20	49.1	0.871
FFX180F	4535	125	5″	470	205	398	23.0	112.0	89	-	-	-	42.2	0.847
FFX180H	4535	125	5″	470	205	398	23.0	112.0	89	-	-	-	42,2	0.847
FFX200B	85	150	-	508	200	429	24.0	-	-	138.0	114	M20	58.2	1.301
FFX200F	4535	125	5″	508	205	429	24.0	113.0	89	-	-	-	53.6	1.281
FFX200H	4535	125	5″	508	205	429	24.0	113.0	89	-	-	-	53.6	1.281
FFX220B	85	160	-	562	218	474	27.5	-	-	154.5	127	M20	79.6	2.142
FFX220F	5040	125	5″	562	223	474	27.5	129-5	102	-	-	-	72,0	2.104
FFX220H	5040	125	5″	562	223	474	27.5	129-5	102	-	-	-	72,0	2.104
FFX250B	88	190	-	628	254	532	29.5	-	-	161.5	132	M20	104.0	3.505
FFX250F	5040	125	5″	628	254	532	29.5	155.5	127	-	-	-	106.0	2.104
FFX250H	5040	125	5″	628	254	532	29.5	155.5	127	-	-	-	106.0	2.104

Notes
G=Wrenchclearanceneededtoallowforthetighteningor1ooseningofthebushontheshaftaswellasthetyreclampingscrews.

Tire Couplings utilizes a highly flexible, cord reinforced rubber tire clamped between steel flanges that mount on to the drive and driven shafts with Tapered Bushings.
The flexible Rubber Tire requires no lubrication which means less required maintenance.
The torsionally soft Rubber Tire provides excellent shock absorption and vibration reduction resulting in increased life of prime mover and driven machinery.
Drive Components Tire Couplings accommodate substantial Angular Misalignment (2 deg), Parallel Misalignment (1%) as well as End Float and Combination Misalignment.
The Rubber Tire provides electrical isolation between driver and driven shafts which eliminates an important cause of bearing failure.
Drive Components Tire Couplings are interchangeable from a ratings and dimensional standpoint with similar tire couplings on the market.

Product detail pictures:

Related Product Guide:

Our mission will be to become an innovative supplier of high-tech digital and communication devices by furnishing benefit added structure, world-class manufacturing, and service capabilities for Reliable Supplier Tgl Gf Couplings - Tyre Couplings Complete Set Type F/H/B with Rubber Tire – GOODLUCK , The product will supply to all over the world, such as: panama, Australia, Kenya, Further, we are supported by highly experienced and knowledgeable professionals, who have immense expertise in their respective domain. These professionals work in close coordination with each other to offer our clients an effective range of products.

Chain Coupling